| 產(chǎn)品詳情 |
Scavenger Receptor Class D Member 1 Antibody is a Rabbit Polyclonal against Scavenger Receptor Class D Member 1.
| Target |
Scavenger Receptor Class D Member 1 (SCARD1) |
| Reactivity |
Mouse |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Tested Applications |
WB, IHC, IF/ICC, IP |
| Recommended dilutions |
WB: 0.5-2 μg/ml, IHC: 5-20 μg/ml, IF/ICC: 5-20 μg/ml. Optimal dilutions/concentrations should be determined by the end user. |
| Immunogen |
SCARD1 (Ala27-Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA) |
| Purification |
Purified by antigen-specific affinity chromatography, followed by Protein A affinity chromatography. |
| Form |
Liquid |
| Conjugation |
Unconjugated |
| Storage |
Aliquot and store at -20°C. Avoid repeated freeze/thaw cycles. |
| Buffer |
0.01 M PBS, pH 7.4, containing 0.05% Proclin-300, 50% glycerol. |
| UNSPSC Code |
12352203 |
| Availability |
Shipped within 5-7 working days. |
| Note |
This product is for research use only. |
|