| Edit |   |
|---|
| Antigenic Specificity | B-Cell CLL/lymphoma 7A (BCL7A) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene. |
|---|
| Immunogen | BCL7 A antibody was raised using the middle region of BCL7 corresponding to a region with amino acids CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN |
|---|
| Other Names | bcl7a|MGC89576|BCL7A|4432415N06Rik|AI448316|BCL7|cb585|id:ibd1097|sb:cb585|wu:fk02d01|zgc:92023 |
|---|
| Gene, Accession # | Gene ID: 605 |
|---|
| Catalog # | ABIN632344 |
|---|
| Price | |
|---|
| Order / More Info | B-Cell CLL/lymphoma 7A (BCL7A) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|