| Edit |   |
| Antigenic Specificity | Exophilin 5 (EXPH5) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | EXPH5 may act as a Rab effector protein and play a role in vesicle trafficking. |
| Immunogen | EXPH5 antibody was raised using the middle region of EXPH5 corresponding to a region with amino acids QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVPEDGLSPSEPL |
| Other Names | KDELC2|DKFZp469K2410|SLAC2-B|SLAC2B|AC079869.22gm5|B130009M24Rik|E030050P12|Kiaa0624|Slac2b|slac2-b|RGD1560308 |
| Gene, Accession # | Gene ID: 23086 |
| Catalog # | ABIN632437 |
| Price | |
| Order / More Info | Exophilin 5 (EXPH5) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |