| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | MEF2C |
| Clone | CBFYM-2030 |
| Host Species | Recombinant Mouse |
| Reactive Species | human |
| Isotype | IgG1 |
| Format | unconjugated |
| Size | n/a |
| Concentration | n/a |
| Applications | WB, IHC, IHC-P |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Mouse Anti-MEF2C Recombinant Antibody (CBFYM-2030). This product is mouse antibody that recognizes MEF2C. The antibody CBFYM-2030 can be used for immunoassay techniques such as: WB, IHC, IHC-P. This locus encodes a member of the MADS box transcription enhancer factor 2 family of proteins, which play a role in myogenesis. The encoded protein, MEF2 polypeptide C, has both trans-activating and DNA binding activities. This protein may play a role in maintaining the differentiated state of muscle cells. Mutations and deletions at this locus have been associated with severe cognitive disability, stereotypic movements, epilepsy, and cerebral malformation. Alternatively spliced transcript variants have been described. |
| Immunogen | Recombinant protein corresponding to amino acids: PPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINN |
| Other Names | Myocyte Enhancer Factor 2C; MADS Box Transcription Enhancer Factor 2, Polypeptide C; Myocyte-Specific Enhancer Factor 2C; C5DELq14.3; DEL5q14.3 |
| Gene, Accession # | Gene ID: 4208, UniProt: Q06413 |
| Catalog # | CBMAB-M2209-FY |
| Price | |
| Order / More Info | MEF2C Antibody from CREATIVE BIOLABS |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|