| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | OGT/O-Linked N-Acetylglucosamine Transferase |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat (predicted: bovine, horse, monkey, rabbit) |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100ug (sample available) |
| Concentration | 500ug/ml. |
| Applications | IHC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband? antibody for UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit(OGT) detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. O-linked N-acetylglucosamine (O-GlcNAc) transferase (OGT) is an enzyme that in humans is encoded by the OGT gene. This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human OGT (1008-1046aa NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA), identical to the related mouse and rat sequences. |
| Other Names | UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit;2.4.1.255 ;O-GlcNAc transferase subunit p110;O-linked N-acetylglucosamine transferase 110 kDa subunit;OGT;OGT; |
| Gene, Accession # | OGT, UniProt: O15294 |
| Catalog # | PB9767 |
| Price | |
| Order / More Info | OGT/O-Linked N-Acetylglucosamine Transferase Antibody from BOSTER BIO |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|