| Edit |   |
|---|
| Antigenic Specificity | Melanoma antigen family E1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Melanoma antigen family E1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Melanoma antigen family E1. This antibody reacts with mouse. The Melanoma antigen family E1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human Magee1. Peptide sequence GRECTKVFPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEDTEE. |
|---|
| Other Names | Alpha-dystrobrevin-associated MAGE Protein, DAMAGEMAGE-E1 antigen, HCA1, hepatocellular carcinoma-associated HCA1, Hepatocellular carcinoma-associated protein 1, KIAA1587dystrobrevin-associated MAGE protein, melanoma antigen family E, 1, melanoma-associated antigen E1 |
|---|
| Gene, Accession # | MAGEE1, Gene ID: 57692, Accession: NP_444431 |
|---|
| Catalog # | NBP1-91489-20ul |
|---|
| Price | |
|---|
| Order / More Info | Melanoma antigen family E1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|