| Edit |   |
|---|
| Antigenic Specificity | Melanoma Antigen Family A, 6 (MAGEA6) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MAGEA6 gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. |
|---|
| Immunogen | MAGEA6 antibody was raised using the middle region of MAGEA6 corresponding to a region with amino acids APEEKIWEELSVLEVFEGREDSIFGDPKKLLTQYFVQENYLEYRQVPGSD |
|---|
| Other Names | Mage-a6|CT1.6|MAGE-3b|MAGE3B|MAGE6 |
|---|
| Gene, Accession # | Gene ID: 4105 |
|---|
| Catalog # | ABIN632131 |
|---|
| Price | |
|---|
| Order / More Info | Melanoma Antigen Family A, 6 (MAGEA6) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|