| Edit |   |
|---|
| Antigenic Specificity | Melanoma Antigen Family A, 4 (MAGEA4) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MAGEA4 is a member of the MAGEA family. The members of this family are proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. |
|---|
| Immunogen | MAGEA4 antibody was raised using the C terminal of MAGEA4 corresponding to a region with amino acids ENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYP |
|---|
| Other Names | Mage-a4|MAGEA4|CT1.4|MAGE-41|MAGE-X2|MAGE4|MAGE4A|MAGE4B |
|---|
| Gene, Accession # | Gene ID: 4103 |
|---|
| Catalog # | ABIN632780 |
|---|
| Price | |
|---|
| Order / More Info | Melanoma Antigen Family A, 4 (MAGEA4) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|