Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The Melanoma antigen family C2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Melanoma antigen family C2. This antibody reacts with human. The Melanoma antigen family C2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Melanoma antigen family C2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASSASSTLYLVFSPS
Other Names
Cancer/testis antigen 10, CT10MAGE-E1 antigen, HCA587MAGE-C2, hepatocellular cancer antigen 587, Hepatocellular carcinoma-associated antigen 587, MAGE-C2 antigen, MAGEE1MGC13377, melanoma antigen family C, 2, melanoma antigen, family E, 1, cancer/testis specific, melanoma-associated antigen C2