| Edit |   |
|---|
| Antigenic Specificity | Melanoma Antigen Family B, 4 (MAGEB4) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEB genes are clustered on chromosome Xp22-p21. This gene sequence ends in the first intron of MAGEB1, another family member. This gene is expressed in testis. |
|---|
| Immunogen | MAGEB4 antibody was raised using the N terminal of MAGEB4 corresponding to a region with amino acids KEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGD |
|---|
| Other Names | CN716893|Mage-b4|mMage-b4|MAGEB17|MAGEB4|RGD1562439|MGC133739|CT3.6 |
|---|
| Gene, Accession # | Gene ID: 4115 |
|---|
| Catalog # | ABIN632604 |
|---|
| Price | |
|---|
| Order / More Info | Melanoma Antigen Family B, 4 (MAGEB4) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|