| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | MAGED2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MAGED2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAGED2. This antibody reacts with human. The MAGED2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MAGED2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LTDTQVLAAENKSLAADTKKQNADPQAVTMPATETKKVSHVADTKVNTKAQETEAAPSQAPADEPEPESAAAQSQENQDTR |
| Other Names | 11B6MAGE-D2 antigen, BCG-1, BCG1MAGEDHCA10, breast cancer associated gene 1, Breast cancer-associated gene 1 protein, hepatocellular carcinoma associated protein, hepatocellular carcinoma-associated protein HCA10, Hepatocellular carcinoma-associated protein JCL-1, JCL-1, MAGE-D2, melanoma antigen family D, 2, melanoma-associated antigen D2, MGC8386 |
| Gene, Accession # | MAGED2, Gene ID: 10916 |
| Catalog # | NBP1-89413 |
| Price | |
| Order / More Info | MAGED2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 25663882 |
| 產(chǎn)品資料 |
|
|