| Edit |   |
|---|
| Antigenic Specificity | GLIPR1L1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GLIPR1L1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GLIPR1L1. This antibody reacts with human. The GLIPR1L1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to GLIPR1L1 (GLI pathogenesis-related 1 like 1) The peptide sequence was selected from the middle region of GLIPR1L1. Peptide sequence NMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFL. |
|---|
| Other Names | ALKN2972, GLI pathogenesis-related 1 like 1, GLIPR1-like protein 1, MGC26856, PRO7434 |
|---|
| Gene, Accession # | GLIPR1L1, Gene ID: 256710 |
|---|
| Catalog # | NBP1-57060 |
|---|
| Price | |
|---|
| Order / More Info | GLIPR1L1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|