| Edit |   |
|---|
| Antigenic Specificity | Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | BCkDaK belongs to the PDK/BCkDaK protein kinase family. It contains 1 histidine kinase domain. BCkDaK catalyzes the phosphorylation and inactivation of the branched-chain alpha-ketoacid dehydrogenase complex, the key regulatory enzyme of the valine, leucine and isoleucine catabolic pathways. BCkDaK is the key enzyme that regulates the activity state of the BCkDa complex. |
|---|
| Immunogen | BCKDK antibody was raised using the N terminal of BCKDK corresponding to a region with amino acids CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD |
|---|
| Other Names | cb233|zgc:55984|wu:fa04g07|wu:fb80b08|MGC78818|BCKDK|AI327402|BCKDKD|BDK |
|---|
| Gene, Accession # | Gene ID: 10295,12041,29603 |
|---|
| Catalog # | ABIN632248 |
|---|
| Price | |
|---|
| Order / More Info | Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|