| Edit |   |
| Antigenic Specificity | TIFAB |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 69%, rat 69%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human TIFAB polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PLSTVNRVSFSGIQMLVRVEEGTSLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQGQ |
| Other Names | TRAF-interacting protein with forkhead-associated domain, family member B |
| Gene, Accession # | Gene ID: 497189, UniProt: Q6ZNK6, ENSG00000255833 |
| Catalog # | HPA049372 |
| Price | |
| Order / More Info | TIFAB Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |