| Edit |   |
|---|
| Antigenic Specificity | Caveolin 1, Caveolae Protein, 22kDa (CAV1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The scaffolding protein CAV1 is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 MAP kinase cascade. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by a single transcript from this gene. |
|---|
| Immunogen | CAV1 antibody was raised using the N terminal of CAV1 corresponding to a region with amino acids SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDL |
|---|
| Other Names | fc07c04|wu:fc07c04|Cav-1|bscl3|cav1|cav1a|cgl3|vip21|cav1b|caveolin-1|cav|mstp085|Caveolin-1|CAV1|cav-1|Cav|caveolin 1|BSCL3|CGL3|MSTP085|PPH3|VIP21 |
|---|
| Gene, Accession # | Gene ID: 857 |
|---|
| Catalog # | ABIN631128 |
|---|
| Price | |
|---|
| Order / More Info | Caveolin 1, Caveolae Protein, 22kDa (CAV1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|