Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Anti-PD1 Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of mouse PD1 (84-117aa NGLSQPVQDARFQIIQLPNRHDFHMNILDTRRND), different from the related human sequence by fifteen amino acids.
Other Names
programmed cell death protein 1; Programmed cell death protein 1; programmed cell death protein 1; programmed cell death 1; CD_antigen: CD279, Pdcd1; Pdcd1; PD-1; Pdc1; Ly101; Pd1; Protein PD-1; mPD-1
1. Barber, D. L., Wherry, E. J., Masopust, D., Zhu, B., Allison, J. P., Sharpe, A. H., Freeman, G. J., Ahmed, R. Restoring function in exhausted CD8 T cells during chronic viral infection. Nature 439: 682-687, 2006. 2. Dai, H., Wan, N., Zhang, S., Moore, Y., Wan, F., Dai, Z. Cutting edge: programmed death-1 defines CD8 CD122 T cells as regulatory versus memory T cells. J. Immun. 185: 803-807, 2010. 3. Finger, L. R., Pu, J., Wasserman, R., Vibhakar, R., Louie, E., Hardy, R. R., Burrows, P.