| Edit |   |
| Antigenic Specificity | Poly (ADP-Ribose) Polymerase 2 (PARP2) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | PARP2 contains a catalytic domain and is capable of catalyzing a poly(ADP-ribosyl)ation reaction. This protein has a catalytic domain which is homologous to that of poly (ADP-ribosyl) transferase, but lacks an N-terminal DNA binding domain which activates the C-terminal catalytic domain of poly (ADP-ribosyl) transferase. The basic residues within the N-terminal region of this protein may bear potential DNA-binding properties, and may be involved in the nuclear and/or nucleolar targeting of protein. |
| Immunogen | PARP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA |
| Other Names | cb996|adprtl2|ADPRT2|ADPRTL2|ADPRTL3|ARTD2|PARP-2|pADPRT-2|Adprtl2|Adprt2|Aspartl2|C78626|ATPARP1|F16D14.16|F16D14_16|poly(ADP-ribose) polymerase 1 |
| Gene, Accession # | Gene ID: 10038 |
| Catalog # | ABIN631010 |
| Price | |
| Order / More Info | Poly (ADP-Ribose) Polymerase 2 (PARP2) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |