| Edit |   |
| Antigenic Specificity | Polyamine Oxidase (Exo-N4-Amino) (PAOX) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine. PAOX does not oxidize spermidine. It plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs. |
| Immunogen | PAOX antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSAVGMEGGRPPPQSVGPAGAAAQAQALAGPSLLCSTRVGGRLGPSFLL |
| Other Names | pao|PAO|2410012F02Rik|AI118225|Pao|mpao1 |
| Gene, Accession # | Gene ID: 196743 |
| Catalog # | ABIN631501 |
| Price | |
| Order / More Info | Polyamine Oxidase (Exo-N4-Amino) (PAOX) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |