If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The Granzyme A Antibody from Novus Biologicals is a rabbit polyclonal antibody to Granzyme A. This antibody reacts with human. The Granzyme A Antibody has been validated for the following applications: Western Blot.
Immunogen
Synthetic peptides corresponding to GZMA(granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3)) The peptide sequence was selected from the middle region of GZMA (NP_006135). Peptide sequence TREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGT
Other Names
CTL tryptase, CTLA3Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3; Hanukah factorserine protease), Cytotoxic T-lymphocyte proteinase 1, EC 3.4.21, fragmentin-1, granzyme A, granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3), Granzyme-1, H factor, Hanukkah factor, HF, HFSPEC 3.4.21.78