| Edit |   |
| Antigenic Specificity | Annexin A2 (ANXA2) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | n/a |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | ANXA2 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. ANXA2 has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for ANXA2. |
| Immunogen | Annexin A2 antibody was raised using the C terminal of ANXA2 corresponding to a region with amino acids RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD |
| Other Names | MGC53008|p36|anx2|lip2|lpc2|cal1h|lpc2d|pap-i|anx2l4|MGC76145|ANXA2|ANX2|ANX2L4|CAL1H|LIP2|LPC2|LPC2D|P36|PAP-IV|AW215814|Cal1h |
| Gene, Accession # | n/a |
| Catalog # | ABIN630252 |
| Price | |
| Order / More Info | Annexin A2 (ANXA2) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |