| Edit |   |
|---|
| Antigenic Specificity | Annexin A6 (ANXA6) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | n/a |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Exon 21 of annexin VI is alternatively spliced, giving rise to two isoforms that differ by a 6-amino acid insertion at the start of the seventh repeat. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis. |
|---|
| Immunogen | Annexin A6 antibody was raised using the C terminal of ANXA6 corresponding to a region with amino acids SDTSGHFRRILISLATGHREEGGENLDQAREDAQVAAEILEIADTPSGDK |
|---|
| Other Names | anxa6|MGC82170|ANXA6|anx6|cbp68|DKFZp459M247|ANX6|CBP68|AW107198|Anx6|AnxVI|Cabm|Camb|CPB-II |
|---|
| Gene, Accession # | n/a |
|---|
| Catalog # | ABIN630245 |
|---|
| Price | |
|---|
| Order / More Info | Annexin A6 (ANXA6) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|