| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | Integrin alpha 3/CD49c |
| Clone | 29A3 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 |
| Format | Alexa Fluor 647 conjugate |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen. Optimal dilution of this antibody should be experimentally determined. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Integrin alpha 3/CD49c Antibody (29A3) [Alexa Fluor? 647] from Novus Biologicals is a mouse monoclonal antibody to Integrin alpha 3/CD49c. This antibody reacts with human. The Integrin alpha 3/CD49c Antibody (29A3) [Alexa Fluor? 647] has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen. Specificity: 29A3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3A |
| Immunogen | Clone 29A3 is a mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin. |
| Other Names | antigen identified by monoclonal J143, CD49 antigen-like family member C, CD49c, CD49c antigen, FLJ34631, FLJ34704, FRP-2, Galactoprotein B3, GAP-B3, GAPB3CD49C, integrin alpha-3, integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor), MSK18, VCA-2, very late activation protein 3 receptor, alpha-3 subunit, VL3A, VLA-3 subunit alpha, VLA3a |
| Gene, Accession # | ITGA3, Gene ID: 3675 |
| Catalog # | NBP1-97692AF647 |
| Price | |
| Order / More Info | Integrin alpha 3/CD49c Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|