Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The PAC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PAC2. This antibody reacts with human. The PAC2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PAC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNPYATTEGNSTELSINAEVYSLPSRKLVALQ
Other Names
CLAST3HSPC260, HCCA3PAC-2, hepatocellular carcinoma susceptibility protein, Hepatocellular carcinoma-susceptibility protein 3, HsT1707, likely ortholog of mouse CD40 ligand-activated specific transcript 3 (Clast3), MDS003, MGC15092, PAC2HDCMC29P, proteasome (prosome, macropain) assembly chaperone 2, proteasome assembling chaperone 2, proteasome assembly chaperone 2, TNFSF5IP1CD40 ligand-activated specific transcript 3, Tumor necrosis factor superfamily member 5-induced protein 1, tumor necrosis factor superfamily, member 5-induced protein 1, x 003 protein