| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | ROR gamma/RORC/NR1F3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ROR gamma/RORC/NR1F3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ROR gamma/RORC/NR1F3. This antibody reacts with human. The ROR gamma/RORC/NR1F3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ROR gamma/RORC/NR1F3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYV |
| Other Names | MGC129539, Nuclear receptor ROR gamma, Nuclear receptor ROR-gamma, Nuclear receptor RZR gamma, Nuclear receptor RZR-gamma, Nuclear receptor subfamily 1 group F member 3, RAR-Related Orphan Nuclear Receptor Variant 2, RAR-related orphan receptor C, RAR-related orphan receptor gamma, retinoic acid-binding receptor gamma, retinoid-related orphan receptor gamma, Retinoid-related orphan receptor-gamma, ROR gamma, RORG, RORGMGC129539, RZRG, RZRGRZR-GAMMA, TOR |
| Gene, Accession # | RORC, Gene ID: 6097 |
| Catalog # | NBP2-56610 |
| Price | |
| Order / More Info | ROR gamma/RORC/NR1F3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|