If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Rabbit IgG polyclonal Picoband? antibody for Carboxypeptidase A detection. Tested with WB in Human;Mouse;Rat. No cross reactivity with other proteins. Carboxypeptidase A1 is an enzyme that in humans is encoded by the CPA1 gene. This gene encodes a member of the carboxypeptidase A family of zinc metalloproteases. This enzyme is produced in the pancreas and preferentially cleaves C-terminal branched-chain and aromatic amino acids from dietary proteins. This gene and several family members are present in a gene cluster on chromosome 7. Mutations in this gene may be linked to chronic pancreatitis, while elevated protein levels may be associated with pancreatic cancer.
Immunogen
A synthetic peptide corresponding to a sequence of human Carboxypeptidase A (KRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLD).