| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | ACTN3 |
| Clone | 9B5 |
| Host Species | Mouse |
| Reactive Species | mouse, rat |
| Isotype | IgG1 |
| Format | unconjugated |
| Size | 100ug |
| Concentration | 0.5-1mg/ml, actual concentration varies by lot. |
| Applications | IHC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Mouse IgG monoclonal Picoband? antibody for ACTN3 detection. Tested with WB, IHC-P in Mouse;Rat. No cross reactivity with other proteins. Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status. |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids. |
| Other Names | Alpha-actinin-3; Alpha-actinin skeletal muscle isoform 3; F-actin cross-linking protein; ACTN3 |
| Gene, Accession # | ACTN3, UniProt: Q08043 |
| Catalog # | M02693 |
| Price | |
| Order / More Info | ACTN3 Antibody from BOSTER BIO |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|