| 產品詳情 |
| Edit |   |
| Antigenic Specificity | Adaptor-Related Protein Complex 1, gamma 1 Subunit (AP1G1) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. AP1G1 is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family. |
| Immunogen | AP1 G1 antibody was raised using the C terminal of AP1 1 corresponding to a region with amino acids DHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTS |
| Other Names | wu:fc30a11|AP1G1|ap1g1|AA409002|AU041323|AW551707|Adtg|D8Ertd374e|ADTG|CLAPG1|adtg|zgc:56079 |
| Gene, Accession # | Gene ID: 164,11765,171494 |
| Catalog # | ABIN632398 |
| Price | |
| Order / More Info | Adaptor-Related Protein Complex 1, gamma 1 Subunit (AP1G1) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |
| 產品資料 |
|
|