| Edit |   |
| Antigenic Specificity | Adaptor-Related Protein Complex 3, mu 2 Subunit (AP3M2) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | AP3M2 is part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. |
| Immunogen | AP3 M2 antibody was raised using the middle region of AP3 2 corresponding to a region with amino acids VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID |
| Other Names | wu:fc15g12|zgc:86670|AP47B|CLA20|P47B|5830445E16Rik|AP-3B |
| Gene, Accession # | Gene ID: 10947,64933,140667 |
| Catalog # | ABIN632155 |
| Price | |
| Order / More Info | Adaptor-Related Protein Complex 3, mu 2 Subunit (AP3M2) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |