| Edit |   |
| Antigenic Specificity | Adaptor-Related Protein Complex 1, mu 2 Subunit (AP1m2) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals. |
| Immunogen | AP1 M2 antibody was raised using the N terminal of AP1 2 corresponding to a region with amino acids MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL |
| Other Names | Ap1m1|zgc:103537|D9Ertd818e|[m]1B|mu1B|AP1-mu2|HSMU1B|MU-1B|MU1B|mu2 |
| Gene, Accession # | Gene ID: 10053 |
| Catalog # | ABIN633108 |
| Price | |
| Order / More Info | Adaptor-Related Protein Complex 1, mu 2 Subunit (AP1m2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |