| Edit |   |
| Antigenic Specificity | Glucosamine-6-Phosphate Deaminase 1 (GNPDA1) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat, C. elegans |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | GNPDA1 belongs to the glucosamine/galactosamine-6-phosphate isomerase family.It seems to trigger calcium oscillations in mammalian eggs. These oscillations serve as the essential trigger for egg activation and early development of the embryo. |
| Immunogen | GNPDA1 antibody was raised using the C terminal of GNPDA1 corresponding to a region with amino acids EGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVD |
| Other Names | gnpda|gnpi|gpi|hln|GNPDA1|zgc:110691|GNPI|GNP1|GNPDA|GPI|HLN|Gnp1|Gnpi|oscillin|AMF|NLK|PGI|PHI|SA-36|SA36 |
| Gene, Accession # | Gene ID: 10007,26384,683570 |
| Catalog # | ABIN631844 |
| Price | |
| Order / More Info | Glucosamine-6-Phosphate Deaminase 1 (GNPDA1) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |