If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Rabbit IgG polyclonal Picoband? antibody for Tyrosine-protein kinase Lyn(LYN) detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. Tyrosine-protein kinase Lyn is a protein that in humans is encoded in humans by the LYN gene. It is mapped to 8q12.1. Lyn is a member of the Src family of protein tyrosine kinases. In various hematopoietic cells, Lyn has emerged as a key enzyme involved in the regulation of cell activation.Lyn has been described to have an inhibitory role in myeloid lineage proliferation.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Lyn (470-501aa DELYDIMKMCWKEKAEERPTFDYLQSVLDDFY), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
Other Names
Tyrosine-protein kinase Lyn;2.7.10.2;Lck/Yes-related novel protein tyrosine kinase;V-yes-1 Yamaguchi sarcoma viral related oncogene homolog;p53Lyn;p56Lyn;LYN;JTK8;