| Edit |   |
| Antigenic Specificity | ADORA2A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 52%, rat 44%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human ADORA2A polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQD |
| Other Names | adenosine A2a receptor, ADORA2, RDC8 |
| Gene, Accession # | Gene ID: 135, UniProt: P29274, ENSG00000128271 |
| Catalog # | HPA075997 |
| Price | |
| Order / More Info | ADORA2A Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |