| Edit |   |
| Antigenic Specificity | UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER. |
| Immunogen | UGCGL1 antibody was raised using the middle region of μgCGL1 corresponding to a region with amino acids AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE |
| Other Names | UGCGL1|ugcgl1|uggt2|0910001L17Rik|A930007H10Rik|AA589501|AI414429|AI448372|C820010P03Rik|GT|UGT1|Ugcgl1|Uggt|rUGT1|HUGT1|EMS-mutagenized bri1 suppressor 1|F3I17.13|F3I17_13|PRIORITY IN SWEET LIFE 2|PSL2|UDP-GLUCOSE:GLYCOPROTEIN GLUCOSYLTRANSFERASE|UGGT |
| Gene, Accession # | Gene ID: 56886 |
| Catalog # | ABIN633063 |
| Price | |
| Order / More Info | UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |