| Edit |   |
| Antigenic Specificity | UDP-Glucuronate Decarboxylase 1 (UXS1) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | UDP-glucuronate decarboxylase catalyzes the formation of UDP-xylose from UDP-glucuronate. UDP-xylose is then used to initiate glycosaminoglycan biosynthesis on the core protein of proteoglycans. |
| Immunogen | UXS1 antibody was raised using the middle region of UXS1 corresponding to a region with amino acids LMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRH |
| Other Names | SDR6E1|UGD|1600025I13Rik|AI451869|AI649125|AW550562|CHUNP6891|fj36b08|wu:fj36b08|zgc:91980 |
| Gene, Accession # | Gene ID: 80146,67883,246232 |
| Catalog # | ABIN636016 |
| Price | |
| Order / More Info | UDP-Glucuronate Decarboxylase 1 (UXS1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |