| Edit |   |
|---|
| Antigenic Specificity | Neuronatin (NNAT) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found within an intron of the BLCAP gene, but on the opposite strand. This gene is imprinted and is expressed only from the paternal allele. Two transcript variants encoding two different isoforms have been found for this gene. |
|---|
| Immunogen | NNAT antibody was raised using the middle region of NNAT corresponding to a region with amino acids MAAVAAASAELLIIGWYIFRVLLQVFRYSLQKLAYTVSRTGRQVLGERRQ |
|---|
| Other Names | Peg5|5730414I02Rik|AW107673 |
|---|
| Gene, Accession # | Gene ID: 4826 |
|---|
| Catalog # | ABIN633088 |
|---|
| Price | |
|---|
| Order / More Info | Neuronatin (NNAT) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|