| Edit |   |
| Antigenic Specificity | Drosha, Ribonuclease Type III (DROSHA) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | RNASEN is a ribonuclease III double-stranded (ds) RNA-specific endoribonuclease that is involved in the initial step of microRNA (miRNA) biogenesis. Component of the microprocessor complex that is required to process primary miRNA transcripts (pri-miRNAs) to release precursor miRNA (pre-miRNA) in the nucleus. |
| Immunogen | RNASEN antibody was raised using the middle region of RNASEN corresponding to a region with amino acids AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK |
| Other Names | im:7150667|zgc:158612|ETOHI2|HSA242976|RANSE3L|RN3|RNASE3L|RNASEN|1110013A17Rik|AI874853|Etohi2|Rn3|Rnasen|RGD1307626 |
| Gene, Accession # | Gene ID: 29102 |
| Catalog # | ABIN633216 |
| Price | |
| Order / More Info | Drosha, Ribonuclease Type III (DROSHA) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |