| Edit |   |
|---|
| Antigenic Specificity | Myeloid Leukemia Factor 1 (MLF1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MLF1 is involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. It interferes with erythopoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. MLF1 suppresses RFWD2/COP1 activity via CSN3 which activates p53 and induces cell cycle arrest.It binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus. |
|---|
| Immunogen | MLF1 antibody was raised using the N terminal of MLF1 corresponding to a region with amino acids GRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQ |
|---|
| Other Names | MLF1|HLS7 |
|---|
| Gene, Accession # | Gene ID: 4291 |
|---|
| Catalog # | ABIN630719 |
|---|
| Price | |
|---|
| Order / More Info | Myeloid Leukemia Factor 1 (MLF1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|