| Edit |   |
| Antigenic Specificity | Jumonji, AT Rich Interactive Domain 2 (JARID2) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation. |
| Immunogen | JARID2 antibody was raised using the N terminal of JARID2 corresponding to a region with amino acids THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ |
| Other Names | JARID2|jarid2|jmj|Jmj|jumonji|JMJ |
| Gene, Accession # | Gene ID: 3720 |
| Catalog # | ABIN633819 |
| Price | |
| Order / More Info | Jumonji, AT Rich Interactive Domain 2 (JARID2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |