If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Anti-TRPV5 Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human TRPV5 (580-610aa DTHWRVAQERDELWRAQVVATTVMLERKLPR), different from the related mouse and rat sequences by one amino acid.Ig Type: Rabbit IgG
Other Names
transient receptor potential cation channel subfamily V member 5; Transient receptor potential cation channel subfamily V member 5; transient receptor potential cation channel subfamily V member 5; transient receptor potential cation channel subfamily V member 5; Calcium transport protein 2; CaT2; Epithelial calcium channel 1; ECaC; ECaC1; Osm-9-like TRP channel 3; OTRPC3, TRPV5; TRPV5; CAT2; ECAC1; OTRPC3; ECAC1; TrpV5; CaT2; ECaC; ECaC1; OTRPC3
1. Clapham DE, Julius D, Montell C, Schultz G (Dec 2005). International Union of Pharmacology. XLIX. Nomenclature and structure-function relationships of transient receptor potential channels.Pharmacol. Rev. 57 (4): 427-50. 2. Muller D, Hoenderop JG, Meij IC, van den Heuvel LP, Knoers NV, den Hollander AI et al. (Nov 2000). Molecular cloning, tissue distribution, and chromosomal mapping of the human epithelial Ca2 channel (ECAC1). Genomics 67 (1): 48-53. 3. Muller D, Hoenderop JG, Merkx GF,