If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Anti-MEFV Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human MEFV(5-39aa PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR), different from the related mouse sequence by eight amino acids, and from the related rat sequence by eleven amino acids.Ig Type: Rabbit IgG
1. Dogan H, Akdemir F, Tasdemir S, Atis O, Diyarbakir E, Yildirim R, Emet M, Ikbal M (2014). A novel insertion mutation identified in exon 10 of the MEFV gene associated with Familial Mediterranean Fever. BMC Medical Genetics 15 (1): 74. 2. Mansfield E, Chae JJ, Komarow HD, Brotz TM, Frucht DM, Aksentijevich I, Kastner DL (Aug 2001). The familial Mediterranean fever protein, pyrin, associates with microtubules and colocalizes with actin filaments. Blood 98(3): 851-9.