| Edit |   |
|---|
| Antigenic Specificity | EVE |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | Drosophila |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | EVE antibody. Specificity: EVE antibody was raised against the N terminal Of Eve |
|---|
| Immunogen | EVE antibody was raised using the N terminal Of Eve corresponding to a region with amino acids MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLS |
|---|
| Other Names | EVE; EVE; 10.5; eve2; 14.10; CG2328; unnamed; Dmel_CG2328; l(2)46Ce; V; 10.9; E(eve); EVE; 20.35; F; VI, |
|---|
| Gene, Accession # | EVE |
|---|
| Catalog # | MBS5302017 |
|---|
| Price | |
|---|
| Order / More Info | EVE Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|