If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Anti-KCNH1 Picoband antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins.
Immunogen
A synthetic peptide corresponding to a sequence of human KCNH1 (AKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKA).Subcellular Localization: Cell membrane.Tissue Specificity: Highly expressed in brain and in myoblasts at the onset of fusion, but not in other tissues. Detected in HeLa (cervical carcinoma), SH-
Other Names
potassium voltage-gated channel subfamily H member 1 isoform 2; Potassium voltage-gated channel subfamily H member 1; potassium voltage-gated channel subfamily H member 1; potassium voltage-gated channel subfamily H member 1; Ether-a-go-go potassium channel 1, KCNH1; KCNH1; EAG; EAG1; ZLS1; TMBTS; h-eag; hEAG1; Kv10.1; ; h-eag; hEAG1