| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | UBE1C/UBA3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat (predicted: bovine, canine, horse, monkey, rabbit) |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100ug (sample available) |
| Concentration | 500ug/ml. |
| Applications | IHC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband? antibody for NEDD8-activating enzyme E1 catalytic subunit(UBA3) detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. NEDD8-activating enzyme E1 catalytic subunit is a protein that in humans is encoded by the UBA3 gene. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, an ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human UBE1C (409-448aa KNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVAD), identical to the related mouse and rat sequences. |
| Other Names | NEDD8-activating enzyme E1 catalytic subunit;6.3.2.-;NEDD8-activating enzyme E1C;Ubiquitin-activating enzyme E1C;Ubiquitin-like modifier-activating enzyme 3;Ubiquitin-activating enzyme 3;UBA3;UBE1C; |
| Gene, Accession # | UBA3, UniProt: Q8TBC4 |
| Catalog # | PB9838 |
| Price | |
| Order / More Info | UBE1C/UBA3 Antibody from BOSTER BIO |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|