| Edit |   |
| Antigenic Specificity | Epithelial Stromal Interaction 1 (Breast) (EPSTI1) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | EPSTI1 was up-regulated in breast carcinomas. The exact function of EPSTI1 is not known. |
| Immunogen | EPSTI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK |
| Other Names | EPSTI1|BRESI1|2310046K10Rik|5033415K03Rik|RGD1563207 |
| Gene, Accession # | Gene ID: 94240 |
| Catalog # | ABIN635669 |
| Price | |
| Order / More Info | Epithelial Stromal Interaction 1 (Breast) (EPSTI1) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |