| Edit |   |
| Antigenic Specificity | RPS15 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 100%, rat 100%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein., Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human RPS15 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MAEVEQKKKRTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQH |
| Other Names | ribosomal protein S15, MGC111130, RIG, S15 |
| Gene, Accession # | Gene ID: 6209, UniProt: P62841, ENSG00000115268 |
| Catalog # | HPA054510 |
| Price | |
| Order / More Info | RPS15 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |