| Edit |   |
|---|
| Antigenic Specificity | Ninjurin 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Ninjurin 1 antibody. Specificity: Ninjurin 1 antibody was raised against the N terminal of NINJ1 |
|---|
| Immunogen | Ninjurin 1 antibody was raised using the N terminal of NINJ1 corresponding to a region with amino acids DSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESM |
|---|
| Other Names | ninjurin-1; Ninjurin-1; ninjurin-1; ninjurin 1; Nerve injury-induced protein 1, NINJ1; NINJ1; NIN1; NINJURIN |
|---|
| Gene, Accession # | Gene ID: 4814, NCBI: NP_004139.2 |
|---|
| Catalog # | MBS5302287 |
|---|
| Price | |
|---|
| Order / More Info | Ninjurin 1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|