| Edit |   |
| Antigenic Specificity | Prostaglandin E Receptor 3 (Subtype EP3) (PTGER3) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Multiple alternatively spliced transcript variants encoding eight distinct isoforms have been reported. |
| Immunogen | PTGER3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QMRKRRLREQLICSLQNSQIQRATAHCGQVQTYRVLNREEMEVLVSSINV |
| Other Names | PTGER3|EP3|EP3-I|EP3-II|EP3-III|EP3-IV|EP3e|PGE2-R|PTGEREP3|Rep3|rEP3a|rEP3b|Pgerep3|Ptgerep3 |
| Gene, Accession # | Gene ID: 5733 |
| Catalog # | ABIN635511 |
| Price | |
| Order / More Info | Prostaglandin E Receptor 3 (Subtype EP3) (PTGER3) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |