| Edit |   |
| Antigenic Specificity | Translocation Associated Membrane Protein 1-Like 1 (TRAM1L1) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | TRAM1L1 is stimulatory or required for the translocation of secretory proteins across the ER membrane. |
| Immunogen | TRAM1 L1 antibody was raised using the middle region of TRAM1 1 corresponding to a region with amino acids LWAIVFILGRLVTLIVSVLTVGFHLAGSQNRNPDALTGNVNVLAAKIAVL |
| Other Names | A830091N21Rik |
| Gene, Accession # | Gene ID: 133022 |
| Catalog # | ABIN635623 |
| Price | |
| Order / More Info | Translocation Associated Membrane Protein 1-Like 1 (TRAM1L1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |