Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The ABCB6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABCB6. This antibody reacts with human. The ABCB6 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human ABCB6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YYRMIQTNFIDMENMFDLLKEETEVKDLPGAGPLRFQKGRIEFENVHFSYADGRETLQD
Other Names
ABC, ATP-binding cassette, sub-family B (MDR/TAP), member 6, EC 3.6.3, EST45597, FLJ22414, mitochondrial, Mitochondrial ABC transporter 3, MTABC3ABC14, P-glycoprotein-related protein, PRP, UMAT