| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | ABCB7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ABCB7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABCB7. This antibody reacts with human. The ABCB7 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ABCB7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKWEAKKENISKEEERKKLQEEI |
| Other Names | ABC transporter 7 protein, ABC7ATP-binding cassette sub-family B member 7, mitochondrial, ASATATP-binding cassette 7, Atm1p, ATP-binding cassette transporter 7, ATP-binding cassette, sub-family B (MDR/TAP), member 7, EC 3.6.3, EC 3.6.3.42, EST140535 |
| Gene, Accession # | ABCB7, Gene ID: 22, Accession: O75027, SwissProt: O75027 |
| Catalog # | NBP1-89313 |
| Price | |
| Order / More Info | ABCB7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|